PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676746066
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family ZF-HD
Protein Properties Length: 223aa    MW: 24248.1 Da    PI: 8.2889
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676746066genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.67.4e-3446100358
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  k+rY+eClkNhA+s+GghavDGC+Efmps ge+g+ +alkCaACgCHRnFHR+e+e
    676746066  46 KIRYRECLKNHAVSIGGHAVDGCCEFMPS-GEDGSLDALKCAACGCHRNFHRKETE 100
                  689*************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-2647100IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.1E-314799IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.2E-294898IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.6644998IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.1E-32147222IPR009057Homeodomain-like
SuperFamilySSF466895.17E-20148221IPR009057Homeodomain-like
TIGRFAMsTIGR015657.6E-28161217IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MNFEEQEEEM EMSGANPTGG YDSLSGEGAT SSGGGGGGRR KSVGGKIRYR ECLKNHAVSI  60
GGHAVDGCCE FMPSGEDGSL DALKCAACGC HRNFHRKETE IMSGRTHRVP TYYNRPPQLP  120
PPGYLHLTSP AAAGQPYRPP AASADEEDTS NPSSSGGTTA KRFRTKFTAE QKEKMLAFAE  180
RLGWRIQKHD DAAVEQFCAE TGVRRQVLKI WMHNNKNSLG KKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-371592181675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3532610.0AK353261.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-39-I06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009138327.11e-139PREDICTED: zinc-finger homeodomain protein 2
SwissprotQ9SB611e-122ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLM4DBG21e-139M4DBG2_BRARP; Uncharacterized protein
STRINGBra013822.1-P1e-138(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45052454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-114homeobox protein 22